Human NFL, His tag Recombinant Protein CD13 regulates activities of numerous

CD13 regulates activities of numerous cytokines by cleaving their N-terminals and is involved in Ag processing by trimming the peptides bound to MHC class II [PMID: 31848300]

so that the staining reagent in the subsequent step can fully enter the nucleus for reaction

CD23 is helpful in the differentiation of chronic lymphocytic leukemia (CD23-positive) from mantle cell lymphoma (CD23-negative)

Specification

Human NFL, His tag Recombinant Protein CD13 regulates activities of numerousProduct Specification Species Human Synonyms Neurofilament light polypeptide, NF L, 68 kDa neurofilament protein, Neurofilament triplet L protein, NEFL, NF68 Accession P07196 Amino Acid Sequence Protein sequence (P07196, Glu397 Ser472, with C 10*His) ETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 10. 2 kDa Observed MW: 15 kDa Purity 90% by SDS PAGE