Pay in 4 interest-free payments of $25.00 Learn more
Ships within 48 hours · Estimated delivery Aug 22 - Aug 27
2、Deford-Watts L M
many viral infections
It is expressed on adaptive immune cell types
CD120a recruits multiple adaptor proteins (such as TRADD) through its intracellular death domain (DD)
Human CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Flag Tag Size:10μg 2、Deford-Watts L MProduct Specification Species Human Synonyms CD8 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C Acidic Tail His tag) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Protein sequence (P10966, Asn19 Pro170, with C Basic Tail Flag tag)
US$ 13.99
US$ 24.00
US$ 39.50
US$ 43.00
US$ 41.00
US$ 13.99
US$ 43.00
US$ 12.50
US$ 15.99