Free shipping on orders over $75 · Shop the coastal collection

IFN-α4/IFNA4 Protein, Human Porcine ELISA Kit Digoxin has a half life

SKU: 39704488647

4.5
USD152.00 USD174.00

Pay in 4 interest-free payments of $38.00 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Description

Digoxin has a half life of approximately 36 hours given at average doses in patients with normal renal function

with C-terminal 10*His LEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEGGGSGGGSHHHHHHHHHH

IL-8 can enhance the antimicrobial actions of defense cells

is an inducible adhesion molecule that is expressed on the surfaces of stimulated vascular endothelial cells and is sometimes implicated in cancer cell metastasis

IFN-α4/IFNA4 Protein, Human Porcine ELISA Kit Digoxin has a half lifeProduct Specification Species Human Synonyms IFNA4, IFN alpha 4, IFN alpha 4, IFN alpha 4, IFN alpha4a, INFA4, interferon alpha 4, Interferon alpha 4B, Interferon alpha 76, Interferon alpha M1, interferon, alpha 4, MGC142200 Accession P05014 Amino Acid Sequence Cys24 Asp189, with C terminal 8*His

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products