Free shipping on orders over $75 · Shop the coastal collection

B7-H7/HHLA2 His Tag Protein, Cynomolgus Size:100μg this molecule has two additional

SKU: 68177971229

4.6
USD240.00 USD284.00

Pay in 4 interest-free payments of $60.00 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 20 - Aug 25

Description

this molecule has two additional Ig-like domains (one V-type and one C-type) and shows a ubiquituous expression pattern

and is widely expressed in normal thyroid and benign thyroid lesions

with C-terminal 8*His LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKKLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARGGGSHHHHHHHH

colon epithelial cells

B7-H7/HHLA2 His Tag Protein, Cynomolgus Size:100μg this molecule has two additionalProduct Specification Species Human Synonyms B7 H7, HHLA2, B7 Homolog 7 Accession XP_005548285 Amino Acid Sequence Ile21 Asn345, with C terminal 8*His

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products