Free shipping on orders over $75 · Shop the coastal collection

Human papillomavirus type 16 E7 Kit FN1 has been shown to

SKU: 61891281987

4.6
USD110.00 USD141.00

Pay in 4 interest-free payments of $27.50 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 20 - Aug 25

Description

FN1 has been shown to play an important role in the regulation of various malignant tumors such as lung cancer

The differentiation of CFU-E (Colony Forming Unit-Erythroid) cells into erythrocytes can only be accomplished in the presence of EPO

148:3618-23

Interleukin-7 Accession P13232 Amino Acid Sequence Asp26-His177

Human papillomavirus type 16 E7 Kit FN1 has been shown toProduct Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

CARTRIDGE 0

US$ 27.50

4.0 (13 reviews)

recommand products