Pay in 4 interest-free payments of $64.00 Learn more
Ships within 48 hours · Estimated delivery Aug 22 - Aug 27
The IL-19 protein is composed of 159 amino acids and has a quaternary structure with alpha helix motifs and loops
RSPO1 stands out among RSPOs molecules with respect to its potential therapeutic use
Compared with trypan blue
in vitro blocking of CD40/CD40L signaling Reactivity Ms Purification Protein G Concentration 5 mg/ml Purity >95% Determined by SDS-PAGE Endotoxin <2EU/mg Conjugation Unconjugated Physical Appearance Liquid Storage Buffer PBS
FABP6 His Tag Protein, Human DNA Immunoprecipitation The IL-19 protein is composedProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
US$ 32.00
US$ 93.00
US$ 126.00
US$ 99.00
US$ 144.00
US$ 72.00
US$ 81.00
US$ 120.00
US$ 76.00
US$ 108.00
US$ 71.00
US$ 115.00
US$ 84.00
US$ 72.00
US$ 67.00
US$ 93.00