Pay in 4 interest-free payments of $29.38 Learn more
Ships within 48 hours · Estimated delivery Aug 22 - Aug 27
Calponin-1 is implicated in the regulation of smooth muscle contraction by mediating intracellular signaling responses to some vasoconstrictors by acting as a contractile scaffold protein
Cytotoxic T-Lymphocyte-Associated Serine Esterase-4
normal cells should show red fluorescence after staining with JC-10
2024 Apr 30
Human CHODL Protein, His tag Size:50μg Calponin-1 is implicated in theProduct Specification Species Human Synonyms Chondrolectin, Transmembrane protein MT75, C21orf68, PRED12 Accession Q9H9P2 Amino Acid Sequence Protein sequence (Q9H9P2, Arg22 Ala211, with C His tag) RRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEA Expression System HEK293 Molecular Weight Predicted MW: 23. 2 kDa
US$ 32.00
US$ 32.00
US$ 32.00
US$ 38.00
US$ 38.00
US$ 17.99
US$ 25.00
US$ 25.00