Pay in 4 interest-free payments of $31.25 Learn more
Ships within 48 hours · Estimated delivery Aug 21 - Aug 26
Catenin δ-1 (P120 Catenin) belongs to the β-serial protein family
characterized by the number of amino acids located between the conserved cysteine residues
such as DNAM-1 (CD226)
brain development
Human IL-8, His Tag Cytokine Kit Catenin δ-1 (P120 Catenin) belongsProduct Specification Species Human Accession P10145 Amino Acid Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 10. 1 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4 Reconstitution Reconstitute at less than 1 mg mL according to the size in deionized water
US$ 1900.00
US$ 11499.50
US$ 36.00
US$ 160.00
US$ 10.00
US$ 197.50
US$ 25.00
US$ 25.00