Free shipping on orders over $75 · Shop the coastal collection

Human IL-28B Protein, His tag Size:25μg 1 part of 20× wash

SKU: 28900614231

4.8
USD117.50 USD146.50

Pay in 4 interest-free payments of $29.38 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Description

1 part of 20× wash buffer was added to 19 parts of distilled water

excellent pH resistance

and lung adenocarcinoma

Immunoglobulin heavy chain-binding protein

Human IL-28B Protein, His tag Size:25μg 1 part of 20× washProduct Specification Species Human Synonyms Interferon lambda 3, IFN lambda 3, Cytokine Zcyto22, Interleukin 28B, Interleukin 28C (IL 28C), IFNL3, IL28B, IL28C, ZCYTO22 Accession Q8IZI9 Amino Acid Sequence Protein sequence (Q8IZI9, Val22 Val196, with C His tag) VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV Expression

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products