Free shipping on orders over $75 · Shop the coastal collection

Trim30a Recombinant Rabbit mAb (S-1753-35) Secondary Antibody it will directly react with

SKU: 10257144231

4.5
USD100.00 USD124.00

Pay in 4 interest-free payments of $25.00 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Description

it will directly react with the antigen on the plate

with C-E tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK

The protein encoded by this gene belongs to the HLA class II beta chain paralogues

it means that the stop solution and the color substrate are not fully mixed

Trim30a Recombinant Rabbit mAb (S-1753-35) Secondary Antibody it will directly react withProduct Specification Host Rabbit Antigen Trim30a Synonyms Tripartite motif containing protein 30A; Down regulatory protein of interleukin 2 receptor; Tripartite motif containing protein 30; Rpt 1; Rpt1; Trim30 Immunogen Synthetic Peptide Location Cytoplasm, Nucleus Accession P15533 Clone Number S 1753 35 Antibody Type Recombinant mAb Isotype IgG Application WB, IHC P, IF Reactivity Ms, Rt Positive Sample A20, CTLL 2, mouse muscle, mouse heart, mouse

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products