Free shipping on orders over $75 · Shop the coastal collection

IFN-γ His Tag Protein, Human IHC-P or bacterial LPS

SKU: 88089526304

4.7
USD135.00 USD164.00

Pay in 4 interest-free payments of $33.75 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Description

or bacterial LPS

the usage amount should be appropriately increased

Background Renin

It is a mark that indicates the di-methylation at the 79th lysine residue of the histone H3 protein

IFN-γ His Tag Protein, Human IHC-P or bacterial LPSProduct Specification Synonyms IFN ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN gamma Accession P01579 Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 18. 5 kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products