Free shipping on orders over $75 · Shop the coastal collection

Apo-SAA2 His Tag, Human Size:100μg and various tumor cell types

SKU: 65102058341

4.4
USD542.50 USD573.50

Pay in 4 interest-free payments of $135.62 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Description

and various tumor cell types

CD67 antigen

2kDa Actual:18

but also by dendritic cells

Apo-SAA2 His Tag, Human Size:100μg and various tumor cell typesProduct Specification Species Human Synonyms Apo SAA2, SAA, SAA2, Serum Amyloid A2 Accession P0DJI9 Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY Expression System E. coli Molecular Weight 13. 2 kDa Purity 95% by SDS PAGE and RP HPLC Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 25mM Arg, 20mM Tris

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products